MUMBAI, India, Sept. 22 -- Intellectual Property India has published a patent application (202617072605 A) filed by Affibody Ab on June 11, 2026, for Her2-Binding Polypeptide.
Inventors include Loftenius, Annika; Ekblad, Caroline; Gunneriusson, Elin; Frejd, Fredrik Number; and Nilsson, Joakim.
The application for the patent was published on September 18, 2026, under issue no. 38/2026.
Abstract: The present disclosure concerns a new polypeptide and fusion proteins which comprise said new polypeptide which bind to Human Epidermal Growth Factor Receptor 2 (in the following referred to as HER2), said new polypeptide comprising the amino acid sequence: EMRNAYWEIALLPNLTNQQKRAFIRKLYDDPSQSSELLSEAKKLNDSQAPEPE The present disclosure also relates to use of such a HER2-binding polypeptide or fusion proteins as a diagnostic agent, prognostic agent, theranostic agent and/or medicament, more particularly use thereof in the diagnosis, prognosis and/or treatment of forms of cancer characterized by over-expression of HER2.
Disclaimer: Curated by HT Syndication.
