MUMBAI, India, May 29 -- Intellectual Property India has published a patent application (202641041612 A) filed by Anu Augustine; and Geethalakshmi Sundararaman, Palakkad, Kerala, on April 1, for 'a novel chemical compound for the treatment of the breast cancer in humans.'

Inventor(s) include Anu Augustine; and Geethalakshmi Sundararaman.

The application for the patent was published on May 29, under issue no. 22/2026.

According to the abstract released by the Intellectual Property India: "Using Insilico technologies, the proposed invention focuses on the unique chemical structure for the anti-cancer effect of protein targets. The structure was predicted, constructed, and evaluated using automated insilico techniques. A novel molecule was produced using chemical repurposing and the computer-aided drug designing (CADD) approach. This new pharmaceutical was verified utilizing pharmacokinetics metrics such as QSAR (Quantitative Structure-Activity Relationship) profiling and ADMET (Absorption, Distribution, Metabolism, Excretion, and Toxicity). The chemical was exposed to anti-cancer targets, specifically ESRI, after its pharmacological similarity score was successfully predicted. The ESRI sequence was employed in protein profiling study. An automated molecular drug docking method was used to dock the domain area. Our suggested chemical structure may bind in the structural domain regions of ESRI, according to the overall docking study results The present invention describes the identification and structural modeling of a novel antigenic peptide derived from the ESRI protein associated with Breast cancer. The peptide sequence KRVPGFVDLTLHDQVHLLECAWLEILMIGLVW was predicted using immunoinformatics tools and modeled using SWISS-MODEL. Model validation demonstrated high structural reliability. The peptide is located within the neurotransmitter-gated ion channel transmembrane pore domain, a critical functional region for drug interaction. Molecular docking identified potential anticancer compounds. The invention provides a novel structural target for structurebased drug design and targeted Breast cancer therapy."

Disclaimer: Curated by HT Syndication.